PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc04136.1.g00020.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 308aa    MW: 33313.7 Da    PI: 4.8499
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc04136.1.g00020.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.92e-31157207151
                                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                                   krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Zpz_sc04136.1.g00020.1.am.mk 157 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFCS 207
                                   79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.6E-41149208IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.277149209IPR002100Transcription factor, MADS-box
CDDcd002658.51E-41150208No hitNo description
SuperFamilySSF554551.83E-29150213IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-32151171IPR002100Transcription factor, MADS-box
PROSITE patternPS003500151205IPR002100Transcription factor, MADS-box
PfamPF003195.4E-26158205IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-32171186IPR002100Transcription factor, MADS-box
PRINTSPR004042.1E-32186207IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MIGTAPSVSR GRTDSDSEER DLPETGYGGP RLGFPPSLCF AGNGNLLSGP LAPTGCFAER  60
ARSLTSAQLL PPVHEMSPTT ITTTVLLVEA CLQLPSLSSS LLALLLSCLG CLLGESDLAA  120
EAEGSWGGKG KQQQQQQEEA PPPPPATAMG RGRVELKRIE NKINRQVTFA KRRNGLLKKA  180
YELSVLCDAE VALIIFSTRG KLYEFCSTQR SARPAIGEDE KQVAFLEYWL MDPELGFGGV  240
PGRDPGDTFG FRLEESNQVL WQQAWEHGER QPEVQPPQPQ LHGGNGFFHP LDAAGETTLQ  300
IGDMPKSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-19149208160Myocyte-specific enhancer factor 2B
1tqe_Q5e-19149208160Myocyte-specific enhancer factor 2B
1tqe_R5e-19149208160Myocyte-specific enhancer factor 2B
1tqe_S5e-19149208160Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4306922e-84AJ430692.1 Zea mays mRNA for putative MADS-domain transcription factor (m6 gene).
GenBankBT0333602e-84BT033360.1 Zea mays full-length cDNA clone ZM_BFb0092L03 mRNA, complete cds.
GenBankBT0426052e-84BT042605.1 Zea mays full-length cDNA clone ZM_BFb0367C04 mRNA, complete cds.
GenBankEU9598672e-84EU959867.1 Zea mays clone 220179 SRF-type transcription factor family protein mRNA, complete cds.
GenBankEU9607112e-84EU960711.1 Zea mays clone 227805 SRF-type transcription factor family protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288311.17e-51MADS-box transcription factor 7-like
SwissprotP0C5B03e-49MADS7_ORYSI; MADS-box transcription factor 7
SwissprotQ0J4663e-49MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBLA0A0E0E0W92e-55A0A0E0E0W9_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0LX972e-55A0A0E0LX97_ORYPU; Uncharacterized protein
STRINGBRADI3G41260.12e-50(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2814435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.32e-35MIKC_MADS family protein